Home / Products / proteins / FABP7, 1-132aa, Human, Recombinant, E.coli

FABP7, 1-132aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
FABP7 (Fatty acid binding protein 7) is also known as brain fatty acid binding protein and is a member of Fatty acid binding proteins (FABPs) which are a family of small, highly conserved, cytoplasmic proteins to bind long-chain fatty acids and other hydrophobic ligands. FABP7 is expressed in radial glia by the activation of Notch receptors and binds DHA with the highest affinity among all of FABPs. Recombinant FABP7 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02078
Size 100 µg
Host E.coli
Accession
Molecular Weight 14kDa (132aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT,2 mM EDTA, 10% glycerol
Other Names Fatty acid binding protein 7, Fatty acid-binding protein, brain, MRG, BLBP, FABPB, B-FABP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap