Home / Products / proteins / FABP3, 1-133aa, Human, His-tagged, Recombinant, E.coli

FABP3, 1-133aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
FABP3 (Fatty acid binding protein 3) is also known as heart fatty acid binding protein and is a member of Fatty acid binding proteins (FABPs) which are a family of small, highly conserved, cytoplasmic proteins to bind long-chain fatty acids and other hydrophobic ligands. FABP3 is abundant in the myocardium and rapidly released from cardiomyocytes into the circulation after the onset of cell damage.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02074
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.1 kDa (170aa)
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Fatty acid binding protein 3, muscle and heart, H-FABP, M-FABP, MDGI, FABP11
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap