FABP2, 1-132 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
FABP2, also known as intestinal fatty acid binding protein 2 (I-FABP), is expressed in the epithelium of the small intestine by mature enterocytes. FABP2 is thought to facilitate of cellular uptake and transport of longchain fatty acids within enterocytes and may also help maintain energy homeostasis by functioning as a lipid sensor. This protein binds saturated long-chain fatty acid with a high affinity, but binds with a low affinity to unsaturated long-chain fatty acid
List Price: $329
  • Buy 5 for $312.55 each and save 5%
  • Buy 21 for $296.1 each and save 10%
  • Buy 31 for $279.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02073
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.3 kDa (152 aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Intestinal fatty acid binding protein 2, FABPI, I-FABP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap