Fabp1, 1-127aa, Rat, His tag, E.coli

Categories: [Proteins / Peptides]
Fabp1 also known as Fatty acid-binding protein. The Protein Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. Fabp1 may be involved in intracellular lipid transport. Recombinant rat Fabp1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02071
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.7kDa (150aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFTLGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffer Saline (pH7.4) containing 20% glycerol, 1mM DTT
Other Names Fatty acid-binding protein, liver, Fabplg, L-FABP, p14, SCP, LFABP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap