Home / Products / proteins / Estrogen Sulfotransferase, 1-294 aa, Human, His-tagged, Recombinant, E.coli

Estrogen Sulfotransferase, 1-294 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. Estrogen sulfotransferase may control the level of the estrogen receptor by sulfurylating free estradiol. Recombinant SULT1E1, fused to His-tag at C-terminus, was expressed in E.coli and was purified by conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02053
Size 100 µg
Host E.coli
Accession
Molecular Weight 36.1kDa (302aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSLPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEILEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol.
Other Names Sulfotransferase family 1E, estrogen-preferring, member 1, SULT1E1, EST, EST-1, STE, Estrogen-preferring EST-1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap