ESM1, 20-184aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Endothelial cell-specific molecule 1, also known as ESM1, is a proteoglycan secreted by endothelial cells and its mRNA expression is regulated by inflammatory cytokines. ESM1 expression has also been detected in different epithelia and in adipocytes. The expression of endocan is upregulated by TNF alpha, IL1 beta, or lipopolysaccharide and downregulated by IFN gamma. Genetically engineered cells overexpressing endocan has been shown to induce tumor formation, suggesting that ESM1 may be involved in the pathophysiology of tumor growth in vivo. Recombinant human ESM1 protein, fused to His-tag at N-terminus, was expressed in E.coli
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02051
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.5 kDa (188aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M Urea, 10% glycerol
Other Names Endothelial cell-specific molecule 1, endocan
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap