Home / Products / proteins / ERH, 1-104aa, Human, His tag, E.coli

ERH, 1-104aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ERH, also known as enhancer of rudimentary homolog, is a ubiquitously expressed transcriptional coregulator that is highly conserved among eukaryotes. It may play a role in cell cycle regulation and pyrimidine biosynthesis. It has two casein kinase II phosphorylation sites that are thought to disrupt the ability of ERH to dimerize. Recombinant human ERH protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02044
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.6 kDa (127aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol0.1M NaCl, 1mM DTT
Other Names Enhancer of rudimentary homolog, DROER, FLJ27340
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap