Home / Products / proteins / EPOR, 25-250aa, Human, His-tag, Baculovirus (Bioactivity Validated)

EPOR, 25-250aa, Human, His-tag, Baculovirus (Bioactivity Validated)

Categories: [Proteins / Peptides]
EPOR, also known as Erythropoietin receptor, mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, it dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. So it may also activate the LYN tyrosine kinase. Recombinant human EPOR, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02037
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 25.6kDa (232aa), 28-40kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Erythropoietin receptor, EPO-R, EPOR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap