Home / Products / proteins / EPCAM, 24-265aa, Human, His tag, E.coli

EPCAM, 24-265aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Epithelial cell adhesion molecules, also known as EPCAM, may act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. This protein plays a role in embryonic stem cells proliferation and differentiation. Recombinant human EPCAM protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $306
  • Buy 5 for $290.7 each and save 5%
  • Buy 21 for $275.4 each and save 10%
  • Buy 31 for $260.1 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02027
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.1 kDa (267aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M urea, 10% glycerol
Other Names Epithelial cell adhesion molecules, CD326, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1, DIAR5, EGP, GA733 2, HNPCC8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap