Home / Products / proteins / ENOPH1, 1-261aa, Human, His tag, E.coli

ENOPH1, 1-261aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Enolase-phosphatase E1, also known as ENOPH1, is a member of the MasA family of the HAD (haloacid dehalogenase)-like hydrolase superfamily. ENOPH1 is a bifunctional enzyme, exhibiting both phosphatase and atypical enolase activities. ENOPH1 plays an important role in the ubiquitous methionine salvage pathway, a biochemical pathway found in all organisms that regulate methionine levels in the cell.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02020
Size 100 µg
Host E.coli
Accession
Molecular Weight 31 kDa (281aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol, 100mM NaCl
Other Names Enolase-phosphatase E1, MASA, MST145
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap