Elongin B, 1-118aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Elongin B , also known as TCEB2, is a subunit of the transcription factor B (SIII) complex. The SIII complex is a heterotrimer consisting of a transcriptionally active subunit (A) and two regulatory subunits (B and C). It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02009
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.1 kDa (118 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mMDTT,0.1 mM PMSF, 20% glycerol
Other Names Transcription elongation factor B polypeptide 2, TCEB2, RNA polymerase II transcription factor SIII subunit B, SIII p18, EloB, Elongin 18 kDa subunit
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap