elF5A, 1-154 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Eukaryotic translation initiation factor 5A (eIF5A) is the only protein Known to contain unusual amino acid formed by the action of deoxyhypusine synthase and deoxyhypusine hydroxylase using spermidine as the substrate. This protein was previously reported to be involved in the first step of peptide bond formation in translation; however more recent work implicates it as a universally conserved translation elongation factor.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02008
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.8 kDa (154 aa) , confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 50 mM Tris-HCl buffer pH 7.5 containing 10 % glycerol
Other Names Eukaryotic translation initiation factor 5A isoform B, EIF-5A, EIF5A1, eIF5AI
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap