Home / Products / proteins / EIF5A2, 1-153aa, Human, His tag, E.coli

EIF5A2, 1-153aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
EIF5A2, a member of eukaryotic initiation factor 5A subfamily, is an essential protein tightly linked to cellular polyamine homeostasis. The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond during the initial stage of protein synthesis.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02005
Size 50 µg
Host E.coli
Accession
Molecular Weight 18.9 kDa(173aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Other Names Eukaryotic translation initiation factor 5A2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap