Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP02001 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 14.7 kDa (138aa) (Real molecular weight on SDS-PAGE will be shift up). |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by BCA assay). |
Formulation | Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Other Names | Eukaryotic translation initiation factor 4E-binding protein 1, 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap