Home / Products / proteins / EIF1AY, 1-144aa, Human, His tag, E.coli

EIF1AY, 1-144aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
EIF1AY is similar to eukaryotic translation initiation factor 1A (EIF1A). This protein seems to be required for maximal rate of protein biosynthesis. It enhances ribosome dissociation into subunits and is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. Recombinant human EIF1AY protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01990
Size 50 µg
Host E.coli
Accession
Molecular Weight 18.8 kDa(167aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1 mM DTT,100 mM NaCl, 20% Glycerol
Other Names Eukaryotic translation initiation factor 1A, Y-linked, eIF-1A Y isoform, eukaryotic translation initiation factor 4C(eIF-4C)
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap