Home / Products / proteins / EIF1, 1-113aa, Human, His tag, E.coli

EIF1, 1-113aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
EIF1, also known as eukaryotic translation initiation factor 1, is a universally conserved translation factor that is necessary for scanning and involved in initiation site selection. This protein promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Recombinant human EIF1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01988
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.9 kDa (150aa)
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWAGSMSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT,0.1 M NaCl, and 10% glycerol
Other Names Eukaryotic translation initiation factor 1, A121, EIF-1, EIF1A, ISO1, SUI1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap