EDA2R, 1-138aa, Human, hIgG-His-tag, Baculovirus

Categories: [Proteins / Peptides]
EDA2R also known as Tumor necrosis factor receptor superfamily member 27 isoform 2, is a transmembrane protein in the TNF receptor superfamily. This protein itself is strongly associated with androgenetic alopecia (male hair loss). It is widely expressed, notably in embryonic basal epidermal cells and maturing hair follicles. Even though it does not contain a cytoplasmic death domain, it can associate with Fas and induce EDA-A2 dependent apoptosis. Recombinant human EDA2R protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01962
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 42.5kDa (380aa)40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPMDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADAPTVPPQEATLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 20% glycerol, 1mM DTT.
Other Names Tumor necrosis factor receptor superfamily member 27 isoform 2, EDA2R, EDA-A2R, EDAA2R, TNFRSF27, XEDAR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap