Home / Products / proteins / DUT, 70-252aa, Human, His tag, E.coli

DUT, 70-252aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DUT, also known as dUTP pyrophosphatase, is a ubiquitous enzyme that functions in nucleotide metabolism. This protein, in the presence of magnesium ions, is responsible for hydrolyzing dUTP to dUMP and diphosphate. This reaction is important for keeping the intracellular dUTP concentration low so that uracil does not become incorporated into DNA.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01943
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.6 kDa (204aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Other Names Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial, dUTPase, dUTP pyrophosphatase, FLJ20622
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap