DUSP23, 1-150aa, Human, His-tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
DUSP23, also known as low molecular mass dual specificity phosphatase 3(LDP-3), belongs to the protein-tyrosine phosphatase family. This protein is a protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. This protein able to enhance activation of JNK and p38(MAPK14). Recombinant human DUSP23 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01939
Size 10 µg
Host E.coli
Accession
Molecular Weight 18.8kDa (170aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 10% glycerol, 100mM NaCl
Other Names Dual specificity protein phosphatase 23, DUSP25, LDP-3, MOSP, VHZ
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap