Home / Products / proteins / DSTN, 1-165aa, Human, His tag, E.coli

DSTN, 1-165aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Destrin (actin depolymerizing factor), also known as DSTN, is a member of the ADF/Cofilin/destrin superfamily that has the ability to rapidly depolymerize F-Actin in a stoichiometric manner. DSTN is a small phosphoinositide-sensitive actin-binding protein capable of depolymerizing actin-filaments in vitro.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01927
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.5 kDa (173aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPVLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol,1mM DTT
Other Names Destrin (actin depolymerizing factor), ACTDP, ADF, bA462D18.2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap