DSCR1 isoform b, 1-117aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
The Down's syndrome candidate region 1 (DSCR1) protein, encoded by a gene located in the human chromosome 21, interacts with calcineurin and is overexpressed in Down's syndrome patients. DSCR1 Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A, possibly affecting central nervous system development.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01926
Size 100 µg
Host E.coli
Accession
Molecular Weight 13kDa (117aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT,100 mM NaCl
Other Names Down syndrome candidate region 1, calcipressin 1 isoform b
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap