Home / Products / proteins / DsbE, 26-185 aa, E.coli, Recombinant, E.coli

DsbE, 26-185 aa, E.coli, Recombinant, E.coli

Categories: [Proteins / Peptides]
DsbE, also called CcmG, is a reducing Dsb protein implicated in electron transfer for cytochrome c maturation in the periplasm of Escherichia coli. DsbE is one of 12 proteins required for their assembly in the periplasm. Its postulated function is to reduce disulphide bonds formed between correctly paired cysteine residues in the cytochrome c apoproteins prior to haem attachment by CcmF and CcmH.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01924
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.1 kDa (161aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAAQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 2 mM EDTA 10% glycerol.
Other Names Thiol:disulfide interchange protein dsbE, CcmG, yejQ
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap