DNAJC24, 1-149aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DnaJ homolog subfamily C member 24, also known as DNAJC24, is a member of the ZCSL family of proteins and each contain one DPH-type zinc finger. This enzyme is involved in the synthesis of diphthamide, a protein found on translation elongation factor EF-2 that is the target of bacterial ADP-ribosylating toxins. DNAJC24 stimulates the ATPase activity of several Hsp70-type chaperones. It is detected in heart, brain, spleen, lung, liver, kidney and testis. Recombinant human DNAJC24 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01901
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.5kDa (172aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names DnaJ homolog subfamily C member 24, DPH4, JJJ3, ZCSL3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap