Home / Products / proteins / DNAJC19, 19-116aa, Human, His tag, E.coli

DNAJC19, 19-116aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DNAJC19 is a single-pass membrane protein that contains a J domain and is localized to the inner membrane of the mitochondrion. Expressed ubiquitously, DNAJC19 functions as a component of the mitochondrial DNAJC19 complex, which is responsible for the ATP-dependent translocation of select proteins from the inner mitochondrial membrane to the mitochondrial matrix.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01900
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.1 kDa (135aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol,2mM DTT, 0.1M NaCl.
Other Names Mitochondrial import inner membrane translocase subunit TIM14, Pam18, TIM14, TIMM14.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap