Home / Products / proteins / DIRAS1, 1-195aa, Human, His tag, E.coli

DIRAS1, 1-195aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases. Ras proteins function as binary molecular switches that control intracellular signaling networks. Rasregulated signal pathways control such processes as actin cytoskeletal integrity, proliferation, differentiation, cell adhesion, apoptosis, and cell migration.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01880
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.1 kDa (215aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 20% glycerol,1mM DTT, 0.1M NaCl, 1mM EDTA.
Other Names GTP-binding protein Di-Ras1,Di-Ras1, FLJ42681, GBTS1, RIG.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap