Home / Products / proteins / DCN, 31-359aa, Human, His tag, Insect cell

DCN, 31-359aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
DCN, also known as decorin isoform, is a small secreted chondroitin/dermatan sulfate proteoglycan within the family of small leucine-rich proteoglycans (SLRPs). This protein has been implicated in matrix assembly and may suppress the growth of various tumor cell lines by inhibiting the epidermal growth factor receptor. Recombinant human DCN, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01838
Size 50 µg
Host Insect cell
Accession
Molecular Weight 37.1kDa (335aa) 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences DEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYKHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names CSCD, DSPG2, PG40, PGII, PGS2, SLRR1B
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap