Ctss, 21-340aa, Mouse, His tag, Baculovirus

Categories: [Proteins / Peptides]
Ctss, as known as cathepsin S isoform 2, is a lysosomal cysteine protease of the papain family. This protein plays a major role in the processing of the MHC class II-associated invariant chain. It has been implicated in the pathogenensis of several diseases such as Alzheimer’s disease and degenerative disorders associated with the cells of the mononuclear phagocytic system. Also, it is less abundant in tissues than Cathepsins B, L and H. The highest levels of this protein have been found in lymph nodes, spleen and phagocytic cells. Recombinant mouse Ctss, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01783
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 37.2kDa (328aa), 28-40KDa (SDS–PAGE under reducing conditions.).
AP_Mol_Weight
Tag N-6His
Sequences VAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEISCRMGALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHHDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Ctss, Cathepsin S
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap