CSTB, 1-98aa, Human, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
CSTB, also known as Cystatin B is an anti-protease implicated in myoclonus epilepsy, a degenerative disease of the central nervous system. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. This protein is able to form a dimer stabilized by noncovalent forces and is thought to play a role in protecting against the proteases leaking from lysosomes. In cells, CSTB is located in the lysosomes and the cytoplasm, but also in the nucleus. Recombinant CSTB, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $159
  • Buy 5 for $151.05 each and save 5%
  • Buy 21 for $143.1 each and save 10%
  • Buy 31 for $135.15 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01759
Size 10 µg
Host E.coli
Accession
Molecular Weight 13 kDa (118aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 50mM NaCl
Other Names Cystatin-B, Stefin B, PME, CST6.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap