CST6, 29-149aa, Human, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
CST6 is a member of the type 2 cystatin family. Some of the members are active cysteine protease inhibitors, while cystatin E/M moderate the inhibition of cathepsin B but is not active against cathepsin C. CST6 is secretable proteins that influence osteogenesis and bone resorption, regulation of the insulin and hepatocyte growth factor receptors, and the response to systemic inflammation. Recombinant human CST6 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $135
  • Buy 5 for $128.25 each and save 5%
  • Buy 21 for $121.5 each and save 10%
  • Buy 31 for $114.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01753
Size 20 µg
Host E.coli
Accession
Molecular Weight 15.9 kDa (142aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl.
Other Names Cystatin-M, Cystatin E/M.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap