Home / Products / proteins / BTF3L4, 1-78aa Human, His tag, E.coli

BTF3L4, 1-78aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
BTF3L4 belongs to the NAC-beta family and contains 1 NAC-A/B (NAC-alpha/beta) domain. Recombinant human BTF3L4 protein isoform 3, fused to His-tag at N-terminus, was expressed in E.coli .
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01375
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.3 kDa (101aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEESWTVKHQNQKTLMRKMMMFQIL
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M Urea
Other Names Transcription factor BTF3 homolog 4 isoform 3, Basic transcription factor 3-like 4
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap