ASF1B, 1-202aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the antisilencing function-1 protein in yeast. This protein is the substrate of the tousled-like kinase family of cell cycleregulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01245
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.4kDa(210aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCILEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.15M NaCl,1mM DTT
Other Names ASF1 anti-silencing function 1 homolog B (S.cerevisiae), CIA-II.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap