ANP32A, 1-249aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ANP32A (acidic leucine-rich nuclear phosphoprotein 32 family member A) has been shown to interact with MAP1B, TAF1A and Protein SET. This protein Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01171
Size 50 µg
Host E.coli
Accession
Molecular Weight 30.7kDa (269aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay).
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl, 0.1mM PMSF.
Other Names Acidic leucine-rich nuclear phosphoprotein 32 family, member A; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32; Mapmodulin.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap