AHSP, 1-102 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
AHSP(Alpha-hemoglobin stabilizing protein), also known as ERAF(Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of α-hemoglobin during normal erythroid cell development.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01090
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.8 kDa (102aa)
AP_Mol_Weight
Tag
Sequences MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names Alpha-hemoglobin stabilizing protein, ERAF, EDRF.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap