AGR 2, 21-175aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01083
Size 100 µg
Host E.coli
Accession
Molecular Weight 22 kDa (192 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSRDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 1 mM EDTA, 10% glycerol
Other Names Anterior gradient 2 homolog, AG2, GOB-4, HAG-2, XAG-2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap