Adiponectin(111-247aa; globular domain), Mouse, Recombinant, expressed in E.coli

Categories: [Proteins / Peptides]
Adiponectin/Acrp30 (247amino acids) is adipocyte complement-related protein of 30kDa and exclusively expressed in differentiated adipocytes. Adiponectin (Acrp30) is a member of the complement factor C1q family and consists of signal sequence, Non-homologous sequence, collagen domain and globular domain (gAcrp30).
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01069
Size 100 µg
Host E.coli
Accession
Molecular Weight 16 kDa (138 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 50 mM NaCl, 5 mM DTT, 10% glycerol
Other Names gAcrp30.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap