Adenylate kinase 3(C22S), 1- 223aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Adenylate kinase (AK; adenosine triphosphate-adenosine monophosphate [ATP-AMP] phosphotransferase, EC 2.7.4.3) is a ubiquitous monomeric enzyme involved energy metabolism of prokaryotic and eukaryotic cells.
List Price: $397
  • Buy 5 for $377.15 each and save 5%
  • Buy 21 for $357.3 each and save 10%
  • Buy 31 for $337.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01060
Size 100 µg
Host E.coli
Accession
Molecular Weight 29.3 kDa (259 aa) , confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASKLLRAVILGPPGSGKGTVSQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 2 mM DTT, 20% glycerol
Other Names AK3; AKL3L; Adenylate kinase 3 alpha like 1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap