ABHD12B,1-255aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ABHD12B belongs to the serine esterase family. Recombinant human ABHD12B protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01017
Size 100 µg
Host E.coli
Accession
Molecular Weight 31.0 kDa (278aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Abhydrolase domain containing 12B, BEM46L3, c14_5314
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap