20kDa Growth Hormone, Human Recombinant, E.coli

Categories: [Proteins / Peptides]
The 20KDa variant form of human growth hormone (20KDa hGH) presents in extracts from pituitary glands and it differs from the major form of hGH (22K, 191 amino acid) by the deletion of amino acid residues 32-46.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP02721
Size 100 µg
Host E.coli
Accession
Molecular Weight 20 kDa (177 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay).
Formulation Liquid. In Phosphate Buffer Saline (pH7.4) containing 10% glycerol.
Other Names 20 kDa hGH
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap