CST5, 26-142aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
CST5, also known as Cystatin-D, is a novel member of the cystatin superfamily. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. Two alleles of the cystatin D gene (CST5), encoding protein variants with either Cys or Arg as residue 26 in their 122-residue polypeptide chains, are present in the population. Recombinant human CST5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01751
Size 50 µg
Host Insect cell
Accession
Molecular Weight 14.36kDa (123aa) (13.5-18kDa in SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences QSRTLAGGIHATDLNDKSVQRALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKVHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by absorbance at 280nm)
Formulation Liquid. In phosphate buffered saline (pH7.4) containing 10% glycerol.
Other Names Cystatin D
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap