CSAG1, 20-78aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CSAG1 is a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein. Recombinant human CSAG1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01735
Size 100 µg
Host E.coli
Accession
Molecular Weight 9.1 kDa (82aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPKREKGPVKEVPGTKGSP
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT.
Other Names Putative chondrosarcoma-associated gene 1 protein, CSAGE, CT24.1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap