CRLF2, 23-231aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
CRLF2, also known as cytokine receptor-like factor 2 isoform 1, is a receptor for thymic stromal lymphopoietin. It is proposed to signal through a heterodimeric receptor complex that consists of a new member of the hemopoietin family termed CRLF2 and the IL-7R alpha-chain. The protein induces phosphorylation of Stat3 and Stat5 also activate JAK2 pathways. CRLF2 and IL-7R alpha are principally coexpressed on monocytes and dendritic cell populations and to a much lesser extent of various lymphoid cells. Recombinant human CRLF2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01716
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 25.2kDa (218aa), 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Cytokine receptor-like factor 2 isoform 1 , CRLF2, CRL2, CRLF2Y, TSLPR
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap