CRCP, 1-148aa, Human, His, E.coli

Categories: [Proteins / Peptides]
CRCP, also known as CGRP-RCP, is an ubiquitous coupling protein for the calcitonin gene-related peptide and adrenomedullin receptors. It modulates ligand responsiveness in a variety of tissues. It has been DNAdirected RNA polymerase activity, catalytic activity and calcitonin receptor activity.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01705
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.0 kDa(168aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names DNA-directed RNA polymerase III subunit RPC9, CGRP-RCP, CGRPRCP, MGC111194, RCP, RCP9.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap