CRABP1, 1-137 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
CRABP1, also known as cellular retinoic acid-binding protein 1, is a member of specific carrier proteins for members of the vitamin A family. This protein is assumed to play an important role in retinoic acidmediated differentiation and proliferation processes.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01702
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.5 kDa (137 aa)
AP_Mol_Weight
Tag
Sequences MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names Cellular retinoic acid binding protein 1, CRABP, CRABP-I, CRABPI, RBP5
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap