Home / Products / proteins / CNRIP1, 1-164aa, Human, His tag, E.coli

CNRIP1, 1-164aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CB1 cannabinoid receptor-interacting protein 1, also known as CNRIP1, is a 164 amino acid protein and G-protein coupled receptor that belongs to the CNRIP family. Involved in appetite, synaptic plasticity, neuroprotection and analgesia, CNRIP1 exists as two alternatively spliced isoforms which have been designated CNRIP1 isoforms 1 and 2, or CRIP1a and CRIP1b, respectively.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01669
Size 100 µg
Host E.coli
Accession
Molecular Weight 21 kDa (187aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 20% glycerol,1mM DTT
Other Names CB1 cannabinoid receptor-interacting protein 1, C2orf32, CRIP1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap