Home / Products / proteins / CNPY1, 1-92aa Human, His tag, E.coli

CNPY1, 1-92aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
CNPY1 is expressed in the midbrain-hindbrain (MHB) boundary in zebrafish, binds FGFR1, and plays a role in FGF signaling. Recombinant human CNPY1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01666
Size 50 µg
Host E.coli
Accession
Molecular Weight 13.3 kDa (115aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANHTEL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names Canopy 1 homolog, Protein canopy homolog 1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap