CMC4, 1-68 aa

Categories: [Proteins / Peptides]
CMC4 was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5’ exon spliced to two different sets of 3’ exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria. Recombinant human CMC4 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01656
Size 100 µg
Host
Accession
Molecular Weight 10.4kDa (93aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSEFMPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT
Other Names C6,1B, MTCP1, MTCP1B, MTCP1NB, p8, p8MTCP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap