Home / Products / proteins / CLTB, 1-211aa Human, His tag, E.coli

CLTB, 1-211aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
CLTB (Clathrin light chain B) belongs to the clathrin light chain family. Clathrin is a protein that plays a major role in the formation of coated vesicles. It forms a triskelion shape composed of three clathrin heavy chains and three light chains.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01652
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.6kDa (234aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Purity > 95% by HPLC
Concentration 1mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 10% glycerol, 0.2mM PMSF, 100mM NaCl
Other Names clathrin, light chain B, LCB.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap