Home / Products / proteins / CLNS1A, 1-237aa, Human, His tag, E.coli

CLNS1A, 1-237aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CLNS1A, also as known as, Methylosome subunit pICln, belongs to the pICln (TC 1.A.47) family. CLNS1A protein has functions in multiple regulatory pathways. This protein interaction with Sm proteins inhibits their assembly on U RNA and interferes with snRNP biogenesis.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01648
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.8kDa (261aa) confirmed by MALDI-TOF(Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol, 2mM DTT
Other Names Methylosome subunit pICln, CLCI, CLNS1B, Icln
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap