Home / Products / proteins / CLIC4, 1-253aa, Human, His tag, E.coli

CLIC4, 1-253aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CLIC4 (chloride intracellular channel 4), also known as H1, CLIC4L or MTCLIC, is a 253 amino acid single-pass membrane protein that localizes to both the nucleus and the cytoplasm and contains one GST Cterminal domain. CLIC4 functions as a monomer that is able to form selective ion channels in target proteins, thereby facilitating the transport of chloride and other ions.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01646
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.9 kDa (273aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.1M NaCl, 1mM DTT, 10% glycerol
Other Names Chloride intracellular channel protein 4, CLIC4L, DKFZp566G223, FLJ38640, H1, huH1, MTCLIC, p64H1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap