Home / Products / proteins / CLEC5A, 28-188aa, Human, His tag, E.coli

CLEC5A, 28-188aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CLE5CA, also known as C-type lectin superfamily member 5 (CLECSF5) and myeloid DAP12-associating lectin 1 (MDL1), is a C-type lectin. It appears to be a member of a significant myeloid lineage activating pathway. This protein functions as a positive regulator of osteoclastogenesis and regulates inflammatory responses. Recombinant human CLEC5A protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01643
Size 50 µg
Host E.coli
Accession
Molecular Weight 20.8 kDa(184aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names C-type lectin domain family 5 member A, CLECSF5, MDL-1, MDL1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap